.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l1p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Closed Form of a Peptidyl-Prolyl Isomerase Reveals the Mechanism of Protein Folding. To be Published
    Site BSGI
    PDB Id 1l1p Target Id TIG_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11966, Molecular Weight 48190.18 Da.
    Residues 432 Isoelectric Point 4.83
    Sequence mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqrygasvrqdvlgd lmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgleaievekpivevtdadvd gmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgqgrmipgfedgikghka geeftidvtfpeeyhaenlkgkaakfainlkkveerelpeltaefikrfgvedgsveglraevrknmer elksairnrvksqaieglvkandidvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrv vvglllgevirtnelkadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlak akvtekettfnelmnqqa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch