.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mc3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia coli Glucose-1-Phosphate Thymidylyltransferase (RffH) Complexed with dTTP and Mg2+. J.BIOL.CHEM. 277 44214-44219 2002
    Site BSGI
    PDB Id 1mc3 Target Id RMLA2_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11962, Molecular Weight 32732.67 Da.
    Residues 293 Isoelectric Point 5.32
    Sequence mkgiilaggsgtrlhpitrgvskqllpiydkpmiyyplsvlmlagireiliittpedkgyfqrllgdgs efgiqleyaeqpspdglaqafiigetflngepsclvlgdniffgqgfspklrhvaartegatvfgyqvm dperfgvvefddnfraisleekpkqpksnwavtglyfydskvveyakqvkpsergeleitsinqmylea gnltvellgrgfawldtgthdslieastfvqtvekrqgfkiacleeiawrngwlddegvkraasslakt gygqyllellrarprqy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.28
    Matthews' coefficent 2.31 Rfactor 0.2232
    Waters 165 Solvent Content 46.70

    Ligand Information
    Ligands TTP (THYMIDINE-5'-TRIPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch