The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase. J.Biol.Chem. 278 31412-31418 2003
    Site BSGI
    PDB Id 1nt4 Target Id AGP_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11933, Molecular Weight 45680.56 Da.
    Residues 413 Isoelectric Point 5.48
    Sequence mnktliaaavagivllasnaqaqtvpegyqlqqvlmmsrhnlraplanngsvleqstpnkwpewdvpgg qlttkggvlevymghymrewlaeqgmvksgecpppytvyayanslqrtvataqffitgafpgcdipvhh qekmgtmdptfnpvitddsaafseqavaamekelsklqltdsyqllekivnykdspackekqqcslvdg kntfsakyqqepgvsgplkvgnslvdaftlqyyegfpmdqvawgeiksdqqwkvlsklkngyqdslfts pevarnvakplvsyidkalvtdrtsapkitvlvghdsniaslltaldfkpyqlhdqnertpiggkivfq rwhdskanrdlmkieyvyqsaeqlrnadaltlqapaqrvtlelsgcpidadgfcpmdkfdsvlneavk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.284
    Matthews' coefficent 2.28 Rfactor 0.218
    Waters 351 Solvent Content 46.07

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch