The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of Shikimate Dehydrogenase Aroe and its Paralog Ydib: A Common Structural Framework for Different Activities. J.Biol.Chem. 278 19463 2003
    Site BSGI
    PDB Id 1o9b Target Id YDIB_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11970, Molecular Weight 31226.14 Da.
    Residues 288 Isoelectric Point 5.03
    Sequence mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgvsmp nkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdikgktmvllgaggasta igaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvtvtdladqqafaealasadiltngtkvg mkpleneslvndisllhpgllvtecvynphmtkllqqaqqagcktidgygmllwqgaeqftlwtgkdfp leyvkqvmgfga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.5 Rfree 0.294
    Matthews' coefficent 2.305 Rfactor 0.226
    Waters 154 Solvent Content 45

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch