.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p9k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of YbcJ from Escherichia coli reveals a recently discovered alphaL motif involved in RNA binding. J.Bacteriol. 185 4204-4210 2003
    Site BSGI
    PDB Id 1p9k Target Id YBCJ_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11968, Molecular Weight 7389.16 Da.
    Residues 70 Isoelectric Point 7.84
    Sequence matfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrckivagqtvsfaghsvqvva
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch