The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecules of Escherichia coli MobB assemble into densely packed hollow cylinders in a crystal lattice with 75% solvent content. Acta Crystallogr.,Sect.D 59 2348-2352 2003
    Site BSGI
    PDB Id 1p9n Target Id MOBB_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11942, Molecular Weight 18873.74 Da.
    Residues 170 Isoelectric Point 5.19
    Sequence mipllafaawsgtgkttllkklipalcargirpglikhthhdmdvdkpgkdsyelrkagaaqtivasqq rwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdgaghrpeelvidrhviavas dvplnldvalldindvegladfvvewmqkqng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.308
    Matthews' coefficent Rfactor 0.275
    Waters 55 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch