.
The Open Protein Structure Annotation Network
PDB Keyword
.

1prz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the RluD pseudouridine Synthase catalytic module, an enzyme that modifies 23S rRNA and is essential for normal cell growth of Escherichia coli. J.Mol.Biol. 335 87-101 2003
    Site BSGI
    PDB Id 1prz Target Id RLUD_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11988, Molecular Weight 37130.76 Da.
    Residues 326 Isoelectric Point 6.31
    Sequence maqrvqltatvsenqlgqrldqalaemfpdysrsrikewildqrvlvngklcdkpkekvlggeqvaina eieeearfepqdipldivyedediivinkprdlvvhpgagnpdgtxlnallhyyppiadvpragivhrl dkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkrthmavhpmgkp avthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggrprppkgaseafistlrkfdr qalhatmlrlyhpisgiemewhapipqdmvelievmradfeehkdevdwl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.243
    Matthews' coefficent 2.64 Rfactor 0.218
    Waters 294 Solvent Content 53.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch