.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ptm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia coli PdxA, an Enzyme Involved in the Pyridoxal Phosphate Biosynthesis Pathway. J.Biol.Chem. 278 43682-43690 2003
    Site BSGI
    PDB Id 1ptm Target Id PDXA_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11960, Molecular Weight 35111.83 Da.
    Residues 329 Isoelectric Point 5.87
    Sequence mvktqrvvitpgepagigpdlvvqlaqrewpvelvvcadatlltnraamlglpltlrpyspnspaqpqt agtltllpvalrapvtagqlavenghyvvetlaracdgclngefaalitgpvhkgvindagipftghte ffeersqakkvvmmlateelrvalatthlplrdiadaitpallheviailhhdlrtkfgiaeprilvcg lnphagegghmgteeidtiipvlnelraqgmklngplpadtlfqpkyldnadavlamyhdqglpvlkyq gfgrgvnitlglpfirtsvdhgtalelagrgkadvgsfitalnlaikmivntq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.267
    Matthews' coefficent 2.38 Rfactor 0.217
    Waters 263 Solvent Content 47.80

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch