The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of Escherichia coli ATP-dependent glucokinase and its complex with glucose. J.Bacteriol. 186 6915-6927 2004
    Site BSGI
    PDB Id 1q18 Target Id GLK_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11986, Molecular Weight 34721.16 Da.
    Residues 321 Isoelectric Point 6.06
    Sequence mtkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgciaiacpitg dwvamtnhtwafsiaemkknlgfshleiindftavsmaipmlkkehliqfggaepvegkpiavygagtg lgvahlvhvdkrwvslpgegghvdfapnseeeaiileilraeighvsaervlsgpglvnlyraivkadn rlpenlkpkditeraladsctdcrralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasg fraafedkgrfkeyvhdipvylivhdnpgllgsgahlrqtlghil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.36 Rfree 0.267
    Matthews' coefficent 2.69 Rfactor 0.20619
    Waters 387 Solvent Content 54.19

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch