.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical evidence for an enzymatic quinone redox cycle in Escherichia coli: identification of a novel quinol monooxygenase. J.Biol.Chem. 280 8358-8363 2005
    Site BSGI
    PDB Id 1r6y Target Id YGIN_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11972, Molecular Weight 11531.81 Da.
    Residues 104 Isoelectric Point 5.79
    Sequence mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsivmieqwesi ahleahlqtphmkayseavkgdvlemnirilqpgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.24948
    Matthews' coefficent 3.43 Rfactor 0.20842
    Waters 185 Solvent Content 64.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch