The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a dodecameric FMN-dependent UbiX-like decarboxylase (Pad1) from Escherichia coli O157: H7. Protein Sci. 13 3006-3016 2004
    Site BSGI
    PDB Id 1sbz Target Id PAD1_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11990, Molecular Weight 21481.77 Da.
    Residues 197 Isoelectric Point 6.38
    Sequence mklivgmtgatgaxlgvallqalrempnvethlvmskwakttieletpysardvaaladfshnpadqaa tissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlvpremplstihlenmlals rmgvamvppmpafynhpetvddivhhvvarvldqfglehpyarrwqglpqarnfsqene
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.21557
    Matthews' coefficent 2.20 Rfactor 0.17648
    Waters 458 Solvent Content 44.00

    Ligand Information
    Ligands FMN (FLAVIN) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch