.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sg7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli. BMC STRUCT.BIOL. 4 9 2004
    Site BSGI
    PDB Id 1sg7 Target Id CHAB_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11981, Molecular Weight 8944.39 Da.
    Residues 76 Isoelectric Point 6.50
    Sequence mpyktksdlpesvkhvlpshaqdiykeafnsawdqykdkedrrddasreetahkvawaavkheyakgdd dkwhkks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch