The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the enzyme GatB of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system and its interaction with GatA. Protein Sci. 15 2435-2441 2006
    Site BSGI
    PDB Id 1tvm Target Id PTKB_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11984, Molecular Weight 10194.43 Da.
    Residues 94 Isoelectric Point 5.84
    Sequence mkrkiivacggavatstmaaeeikelcqshnipveliqcrvneietymdgvhlicttarvdrsfgdipl vhgmpfvsgvgiealqnkiltilqg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch