.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u5w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Identification of an ITPase/XTPase in Escherichia coli by Structural and Biochemical Analysis. Structure 13 1511-1520 2005
    Site BSGI
    PDB Id 1u5w Target Id YJJX_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11977, Molecular Weight 18211.65 Da.
    Residues 170 Isoelectric Point 5.73
    Sequence mhqvvcattnpakiqailqafheifgegschiasvavesgvpeqpfgseetragarnrvanarrllpea dfwvaieagidgdstfswvvienasqrgearsatlplpavilekvregealgpvmsrytgideigrkeg aigvftagkltrasvyhqavilalspfhnavy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 7
    Resolution (Å) 2.30 Rfree 0.255
    Matthews' coefficent 2.40 Rfactor 0.2
    Waters 682 Solvent Content 49.40

    Ligand Information
    Ligands SO4 (SULFATE) x 15
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch