.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xk7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia coli Crotonobetainyl-CoA: Carnitine CoA-Transferase (CaiB) and Its Complexes with CoA and Carnitinyl-CoA. Biochemistry 44 5728-5738 2005
    Site BSGI
    PDB Id 1xk7 Target Id CAIB_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11934, Molecular Weight 45124.39 Da.
    Residues 405 Isoelectric Point 5.13
    Sequence mdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsrrnlhal slnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahlsgfgqygteeytnlp ayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaalhkvretgkgesidiamyevmlrm gqyfmmdyfnggemcprmskgkdpyyagcglykcadgyivmelvgitqieecfkdiglahllgtpeipe gtqlihriecpygplveekldawlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqt mdgrtckgpnimpkfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.60 Rfree 0.213
    Matthews' coefficent 2.40 Rfactor 0.187
    Waters 1174 Solvent Content 48.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch