.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yni

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-succinylarginine dihydrolase AstB, bound to substrate and product, an enzyme from the arginine catabolic pathway of Escherichia coli. J.Biol.Chem. 280 15800-15808 2005
    Site BSGI
    PDB Id 1yni Target Id ASTB_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11955, Molecular Weight 49295.95 Da.
    Residues 447 Isoelectric Point 5.74
    Sequence mnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqavippherpf ipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtldgkvhltvanlnnkfhr sleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrlgghygepgmqlfvygreegndtrps ryparqtreaseavarlnqvnpqqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllan lrarvngfmaievpatqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpi selkvfdlresmangggpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladp qllregrealdvlsqllnlgsvypfqregggng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.265
    Matthews' coefficent 2.20 Rfactor 0.219
    Waters 567 Solvent Content 43.00

    Ligand Information
    Ligands SUG (N~2~-(3-CARBOXYPROPANOYL)-L-ARGININE) x 4
    Metals K (POTASSIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch