.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zps

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Methanobacterium thermoautotrophicum Phosphoribosyl-AMP Cyclohydrolase HisI. Biochemistry 44 10071-10080 2005
    Site BSGI
    PDB Id 1zps Target Id HIS3_METTH
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS11958, Molecular Weight 15457.59 Da.
    Residues 138 Isoelectric Point 5.19
    Sequence mikskgdvnillnfrhningedliiavaqdhetgevlmvaymnrealrrtletgtahywstsrgklwlk gessghvqrvkdvlvdcdgdavvlkveqeggachtgyrscfyrsidgdelkvredavkvfdpeeiygdg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.235
    Matthews' coefficent 2.10 Rfactor 0.207
    Waters 135 Solvent Content 39.70

    Ligand Information
    Ligands ACY (ACETIC) x 5
    Metals CD (CADMIUM) x 19

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch