.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ahw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic trapping of the glutamyl-CoA thioester intermediate of family I CoA transferases. J.Biol.Chem. 280 42919-42928 2005
    Site BSGI
    PDB Id 2ahw Target Id YDIF_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11982, Molecular Weight 57501.03 Da.
    Residues 531 Isoelectric Point 5.52
    Sequence mkpvkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnlsiispt glgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltqtlraaaahqpgiisd igigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdiafirattcdsegyatfedevmyld alviaqavhnnggivmmqvqkmvkkatlhpksvripgylvdivvvdpdqsqlyggapvnrfisgdftld dstklslplnqrklvarralfemrkgavgnvgvgiadgiglvareegcaddfiltvetgpiggitsqgi afganvntraildmtsqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfidisatskkiif cgtltagslkteiadgklnivqegrvkkfirelpeitfsgkialergldvryiteravftlkedglhli eiapgvdlqkdildkmdftpvispelklmderlfidaamgfvlpeaah
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.23545
    Matthews' coefficent 2.43 Rfactor 0.18592
    Waters 1304 Solvent Content 48.00

    Ligand Information
    Ligands COA (COENZYME) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch