The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mechanism of bacterial cell-surface attachment revealed by the structure of cellulosomal type II cohesin-dockerin complex. Proc.Natl.Acad.Sci.Usa 103 305-310 2006
    Site BSGI
    PDB Id 2b59 Target Id P71143_CLOTM
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS11935, Molecular Weight 68615.58 Da.
    Residues 631 Isoelectric Point 5.43
    Sequence mrkkkrlislllavfiavaclpagiaradkassielkfdrnkgevgdiligtvrinniknfagfqvniv ydpkvlmavdpetgkeftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaee sgiiakigfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlslgdepyetpgtdi pisdnpaatpsstpsvtpspevkptqtpspaensakvelepvldnatgeakaaideeklnkaldeakks eddklvelnikkvenadayiqqlpakfliksdaeyklriateqgiievpanmlntadisklvkndsvve fvirkvkvdelgaelkekignrpvidisvvvdgkkvewsnykakvkisipykpdakelenhehivvlhi ddagkavsvpsgkyepslgvvtfetnhlskyavsyvyktfadigsyawakkqievlaskgvingtsdtt ftpqaditradfmillvkalgltaevtsnfddvsekdyyyeyvgiakelgittgvgnnkfnpkakitrq dmmvlttnalriagkisstgtradverfsdkdqiasyavegvatlvkegivvgsgdiinprgnasrael aaiiykiyyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.11 Rfree 0.246
    Matthews' coefficent 2.36 Rfactor 0.205
    Waters 307 Solvent Content 47.87

    Ligand Information
    Metals CA (CALCIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch