The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical characterization of gentisate 1,2-dioxygenase from Escherichia coli O157:H7. Mol.Microbiol. 61 1469-1484 2006
    Site BSGI
    PDB Id 2d40 Target Id Z3393_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11985, Molecular Weight 38477.27 Da.
    Residues 342 Isoelectric Point 5.56
    Sequence mtdnnqnsreqfyqhisgqnltplweslhhlvpktpnancapaywnyqeirplllesggligakeavrr vlvlenpalrgqssitatlyaglqlimpgevapshrhnqsalrfivegkgaftavdgertpmnegdfil tpqwrwhdhgnpgdepviwldgldlplvnilgcgfaedypeeqqpvtrkegdylpryaanmlplrhqtg nsspifnyrydrsrevlhdltrlgdadewdgykmryvnpvtggypmpsmgaflqllpkgfasrvarttd stiyhvvegsgqviignetfsfsakdifvvptwhgvsfqttqdsvlfsfsdrpvqealglfreary
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.41 Rfree 0.24936
    Matthews' coefficent 1.90 Rfactor 0.1734
    Waters 516 Solvent Content 36.40

    Ligand Information
    Metals FE (FE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch