The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site BSGI
    PDB Id 2f79 Target Id NAPD_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11959, Molecular Weight 9468.04 Da.
    Residues 87 Isoelectric Point 4.13
    Sequence mhtnwqvcslvvqakserisdistqlnafpgcevavsdapsgqlivvveaedsetliqtiesvrnvegv lavslvyhqqeeqgeetp
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch