.
The Open Protein Structure Annotation Network
PDB Keyword
.

2flo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of the Exopolyphosphatase (PPX) from Escherichia coli O157:H7 Suggests a Binding Mode for Long Polyphosphate Chains. J.Mol.Biol. 359 1249-1260 2006
    Site BSGI
    PDB Id 2flo Target Id PPX_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11987, Molecular Weight 58132.94 Da.
    Residues 513 Isoelectric Point 6.65
    Sequence mpihdksprpqefaavdlgsnsfhmviarvvdgamqiigrlkqrvhladglgpdnmlseeamtrglncl slfaerlqgfspasvcivgthtlrqalnatdflkraekvipypieiisgneearlifmgvehtqpekgr klvidigggstelvigenfepilvesrrmgcvsfaqlyfpggvinkenfqrarmaaaqkletltwqfri qgwnvamgasgtikaahevlmemgekdgiitperleklvkevlrhrnfaslslpglseerktvfvpgla ilcgvfdalairelrlsdgalregvlyemegrfrhqdvrsrtasslanqyhidseqarrvldttmqmye qwreqqpklahpqleallrwaamlhevglninhsglhrhsayilqnsdlpgfnqeqqlmmatlvryhrk aiklddlprftlfkkkqflpliqllrlgvllnnqrqatttpptltlitddshwtlrfphdwfsqnalvl ldlekeqeywegvagwrlkieeestpeiaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.2471
    Matthews' coefficent 2.73 Rfactor 0.20248
    Waters 630 Solvent Content 54.91

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch