.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fsu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PhnH: an essential component of carbon-phosphorus lyase in Escherichia coli. J.Bacteriol. 190 1072-1083 2008
    Site BSGI
    PDB Id 2fsu Target Id PHNH_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11961, Molecular Weight 21026.09 Da.
    Residues 194 Isoelectric Point 5.28
    Sequence mtletafmlpvqdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtpvwlstpln ndivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalstgtavapeagatlilqvaslsggrmlrl tgagiaeermiapqlpecilhelterphpfplgidliltcgerllaiprtthvevc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.24842
    Matthews' coefficent 1.93 Rfactor 0.18789
    Waters 184 Solvent Content 36.22

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch