.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ft0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TDP-Fucosamine Acetyltransferase (WecD) from Escherichia coli, an Enzyme Required for Enterobacterial Common Antigen Synthesis. J.Bacteriol. 188 5606-5617 2006
    Site BSGI
    PDB Id 2ft0 Target Id WECD_ECOL6
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS11930, Molecular Weight 24217.00 Da.
    Residues 224 Isoelectric Point 6.60
    Sequence mpvrasiepltwenaffgvnsaivritseaplltpdalapwsrvqakiaasntgeldalqqlgfslveg evdlalpvnnvsdsgavvaqetdipalrqlasaafaqsrfrapwyapdasgrfyaqwienavrgtfdhq clilraasgdirgyvslrelnatdarigllagrgagaelmqtalnwayargkttlrvatqmgntaalkr yiqsganvestaywlyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.66 Rfree 0.2232
    Matthews' coefficent 2.73 Rfactor 0.20248
    Waters 412 Solvent Content 54.91

    Ligand Information
    Ligands ACO (ACETYL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch