.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ovi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and heme binding properties of Escherichia coli O157:H7 ChuX. Protein Sci. 18 825-838 2009
    Site BSGI
    PDB Id 2ovi Target Id CHUX_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11994, Molecular Weight 18327.89 Da.
    Residues 164 Isoelectric Point 5.75
    Sequence mshvslqeflktepdgtlevvaeqynttllevvrnlpsstvvpgdkfdtvwdtvcewgnvttlvhtadv ilefsgelpsgfhrhgyfnlrgkhgmsghikaencthialierkfmgmdtasilffnkegsamlkiflg rddhrqllseqvsafhtlaaslkeha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.05 Rfree 0.25
    Matthews' coefficent 2.81 Rfactor 0.213
    Waters 360 Solvent Content 56.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch