The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel structure of the conserved gram-negative lipopolysaccharide transport protein A and mutagenesis analysis. J.Mol.Biol. 380 476-488 2008
    Site BSGI
    PDB Id 2r1a Target Id YHBN_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11973, Molecular Weight 20125.93 Da.
    Residues 185 Isoelectric Point 8.96
    Sequence mkfktnklslnlvlassllaasipafavtgdtdqpihiesdqqsldmqgnvvtftgnvivtqgtikina dkvvvtrpggeqgkevidgygkpatfyqmqdngkpveghasqmhyelakdfvvltgnaylqqvdsnikg dkitylvkeqkmqafsdkgkrvttvlvpsqlqdknnkgqtpaqkkgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 7
    Resolution (Å) 3.26 Rfree 0.36086
    Matthews' coefficent 4.14 Rfactor 0.29801
    Waters 68 Solvent Content 70.32

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch