.
The Open Protein Structure Annotation Network
PDB Keyword
.

3be6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Trapping open and closed forms of FitE-A group III periplasmic binding protein. Proteins 75 598-609 2008
    Site BSGI
    PDB Id 3be6 Target Id FITE_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11992, Molecular Weight 34485.74 Da.
    Residues 315 Isoelectric Point 6.40
    Sequence mrlffsllillsffaratepvqvftddlgrkvtvpahpkrivslhdlditiplielgvppvashgrtrp dgshfirsgalltgvdfdnssiafigtadidieaivaakpdliiteptrntpierlekiaptvsidhlk ggapeiyrklaeltgtqsqlailerryqaqinalkatldsqkitvsviqanqgkinvmhsyhslgrvlr dagfrfppliesipeggrmdvsaerlpeldadfvfatwrgdtggkpqdelaamekvmpgwcqfltacrs gryvlisreeaisnsfaslglmaaqiqsqiagrplpeak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.82 Rfree 0.21851
    Matthews' coefficent 2.36 Rfactor 0.18823
    Waters 807 Solvent Content 47.78

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals CL (CHLORIDE) x 7;MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch