The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of L-xylulose-5-phosphate 3-epimerase UlaE from the Anaerobic L-ascorbate Utilization Pathway of Escherichia coli. Binding Motif within a TIM Barrel Fold. J.Bacteriol. 2008
    Site BSGI
    PDB Id 3cqj Target Id ULAE_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11996, Molecular Weight 32046.99 Da.
    Residues 284 Isoelectric Point 5.13
    Sequence mlskqiplgiyekalpagecwlerlqlaktlgfdfvemsvdetderlsrldwsreqrlalvnaivetgv rvpsmclsahrrfplgseddavraqgleimrkaiqfaqdvgirviqlagydvyyqeannetrrrfrdgl kesvemasraqvtlameimdyplmnsiskalgyahylnnpwfqlypdignlsawdndvqmelqagighi vavhvkdtkpgvfknvpfgegvvdfercfetlkqsgycgpyliemwsetaedpaaevakardwvkarma kagmveaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.04 Rfree 0.213
    Matthews' coefficent 2.20 Rfactor 0.183
    Waters 193 Solvent Content 44.13

    Ligand Information
    Metals ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch