The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the bifunctional isocitrate dehydrogenase kinase/phosphatase. Nature 465 961-965 2010
    Site BSGI
    PDB Id 3eps Target Id ACEK_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS26960, Molecular Weight 67731.17 Da.
    Residues 578 Isoelectric Point 6.08
    Sequence mprglelliaqtilqgfdaqygrflevtsgaqqrfeqadwhavqqamknrihlydhhvglvveqlrcit ngqstdaefllrvkehytrllpdyprfeiaesffnsvycrlfdhrsltperlfifssqperrfrtiprp lakdfhpdhgwesllmrvisdlplrlhwqnksrdihyiirhltetlgpenlskshlqvanelfyrnkaa wlvgklitpsgtlpfllpihqtddgelfidtcltttaeasivfgfarsyfmvyaplpaalvewlreilp gkttaelymaigcqkhaktesyreylvylqgcneqfieapgirgmvmlvftlpgfdrvfkvikdkfapq kemsaahvracyqlvkehdrvgrmadtqefenfvlekrhispalmelllqeaaekitdlgeqivirhly ierrmvplniwleqvegqqlrdaieeygnairqlaaanifpgdmlfknfgvtrhgrvvfydydeicymt evnfrdippprypedelasepwysvspgdvfpeefrhwlcadprigplfeemhadlfradywralqnri reghvedvyayrrrqrfsvrygemlf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.268
    Matthews' coefficent 3.83 Rfactor 0.233
    Waters 50 Solvent Content 67.89

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch