.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g2q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics. Chem.Biol. 16 401-410 2009
    Site BSGI
    PDB Id 3g2q Target Id MTFA_AMYOR
    Molecular Characteristics
    Source Amycolatopsis orientalis
    Alias Ids TPS26956, Molecular Weight 30484.71 Da.
    Residues 280 Isoelectric Point 5.05
    Sequence msnqlergpvrtphadvllasvgergvlcdfydegaadtyrdliqdadgtsearefatrtgpvsgpvle laagmgrltfpfldlgwevtalelstsvlaafrkrlaeapadvrdrctlvqgdmsafaldkrfgtvvis sgsineldeadrrglyasvrehlepggkfllslamseaaeseplerkqelpgrsgrryvlhvrhlpaee iqeitihpadettdpfvvcthrrrllapdqvvrelvrsgfdviaqtpfasggagrkdmvlveavmpgat adar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.18 Rfree 0.253
    Matthews' coefficent 2.55 Rfactor 0.226
    Waters 124 Solvent Content 51.77

    Ligand Information
    Ligands SFG (ADENOSYL-ORNITHINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch