The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of ATTp, an Arabidopsis thaliana Trypsin Inhibitor. Biochemistry 41 12284-12296 2002
    Site CESG
    PDB Id 1jxc Target Id GO.9161
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30270,5056 Molecular Weight 9884.93 Da.
    Residues 89 Isoelectric Point 6.16
    Sequence makaivsifvvffifflvisdvpeieaqgneclkeyggdvgfgfcaprifpticytrcrenkgakggrc rwgqgsnvkclcdfcddtpq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch