.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q45

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Arabidopsis At2g06050, 12-oxophytodienoate reductase isoform 3. Proteins 58 243-245 2005
    Site CESG
    PDB Id 1q45 Target Id GO.8210
    Related PDB Ids 2g5w 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30327, Molecular Weight 42689.02 Da.
    Residues 391 Isoelectric Point 7.71
    Sequence mtaaqgnsnetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmvsp gsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspisstnkpisenrw rvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihgahgylidqflkdgindrtdq yggsianrcrflkqvvegvvsaigaskvgvrvspaidhldatdsdplslglavvgmlnklqgvngskla ylhvtqpryhaygqtesgrqgsdeeeaklmkslrmayngtfmssggfnkelgmqavqqgdadlvsygrl fianpdlvsrfkidgelnkynrktfytqdpvvgytdypflapfsrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23588
    Matthews' coefficent 2.37 Rfactor 0.18635
    Waters 410 Solvent Content 47.60

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch