The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein At2g24940.1 from Arabidopsis thaliana has a cytochrome b5 like fold. J.Biomol.NMR 30 215-218 2004
    Site CESG
    PDB Id 1t0g Target Id GO.6705
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30252,6813 Molecular Weight 11030.70 Da.
    Residues 100 Isoelectric Point 4.81
    Sequence meftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkdasralgkmskneedvsps legltekeintlndwetkfeakypvvgrvvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch