The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Letter to the Editor: Solution structure of a calmodulin-like calcium-binding domain from Arabidopsis thaliana. J.Biomol.NMR 30 451-456 2004
    Site CESG
    PDB Id 1tiz Target Id GO.33909
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30338,6209 Molecular Weight 7776.33 Da.
    Residues 67 Isoelectric Point 4.40
    Sequence msakrvfekfdknkdgklsldefrevalafspyftqedivkffeeidvdgngelnadeftsciekml
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch