.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vk0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Structure of Gene Product from Arabidopsis Thaliana At5g06450. To be published
    Site CESG
    PDB Id 1vk0 Target Id GO.22116
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30183, Molecular Weight 23214.10 Da.
    Residues 206 Isoelectric Point 4.92
    Sequence masfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfpetetktkts gwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllrenhglvirnainvg klaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeqleaaaiegwlivnvwdqlsde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.2326
    Matthews' coefficent 2.80 Rfactor 0.1803
    Waters 645 Solvent Content 56.04

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch