.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vk5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure at 1.6 A resolution of the protein from gene locus At3g22680 from Arabidopsis thaliana. Acta Crystallogr.,Sect.F 61 647-650 2005
    Site CESG
    PDB Id 1vk5 Target Id GO.13974
    Related PDB Ids 3gan 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS29830, Molecular Weight 18025.33 Da.
    Residues 157 Isoelectric Point 5.11
    Sequence melrpsgdsgssdvdaeisdgfspldtshrdvadegsllrraemyqdymkqvpiptnrgslipftswvg lsismkqlygqplhyltnvllqrwdqsrfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmal lwrsdpmyhsfidpifpek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.1835
    Matthews' coefficent 3.38 Rfactor 0.1599
    Waters 172 Solvent Content 63.63

    Ligand Information
    Ligands SO4 (SULFATE) x 3;CPS (3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-) x 1;EDO (1,2-ETHANEDIOL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch