.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xfi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure at 1.7 A resolution of the protein product of the At2g17340 gene from Arabidopsis thaliana. Acta Crystallogr.,Sect.F 61 630-635 2005
    Site CESG
    PDB Id 1xfi Target Id GO.8195
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS29826, Molecular Weight 39814.24 Da.
    Residues 357 Isoelectric Point 5.12
    Sequence mesdsemvpfpqlpmpiennyractipyrfpsddpkkatpneiswinvfansipsfkkraesditvpda paraekfaeryagiledlkkdpeshggppdgillcrlreqvlrelgfrdifkkvkdeenakaislfpqv vslsdaieddgkrlenlvrgifagnifdlavktwfhdhgslmtwktskpngsislgrrslicfalpfna sfrlqclfselkytlncsssssfpfkvvlaanelpsinditctelteilsqlkdengqllgvdtsklli ansgndlpvidlsrvsqelaylssdadlvivegmgrgietnlyaqfkcdslkigmvkhlevaeflggrl ydcvfkfnevqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2213
    Matthews' coefficent 2.08 Rfactor 0.1689
    Waters 357 Solvent Content 40.89

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch