The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of thioredoxin h1 from Arabidopsis thaliana. Protein Sci. 14 2195-2200 2005
    Site CESG
    PDB Id 1xfl Target Id GO.14751
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30296,6318 Molecular Weight 12672.06 Da.
    Residues 114 Isoelectric Point 5.64
    Sequence maseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapffadlakklpnvlflkvdtde lksvasdwaiqamptfmflkegkildkvvgakkdelqstiakhla
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch