.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xm8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural studies on a mitochondrial glyoxalase II. J.Biol.Chem. 280 40668-40675 2005
    Site CESG
    PDB Id 1xm8 Target Id GO.9639
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30173, Molecular Weight 35839.11 Da.
    Residues 324 Isoelectric Point 9.00
    Sequence mqtiskassatsffrcsrklssqpcvrqlnirkslvcrvmklvssplrtlrgagksirvskfcsvsnvs slqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydhtggnlelkd rygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghislyfpgsraiftgdtmfsls cgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfalslepnnevlqsyaahvaelrskklpt ipttvkmekacnpflrssntdirralripeaadeaealgiirkakddf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.74 Rfree 0.189
    Matthews' coefficent 2.32 Rfactor 0.14
    Waters 547 Solvent Content 47.08

    Ligand Information
    Ligands ACY (ACETIC) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals ZN (ZINC) x 2;FE (FE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch