The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1. Protein Sci. 14 2095-2102 2005
    Site CESG
    PDB Id 1xo3 Target Id GO.34198
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30187,6337 Molecular Weight 11322.48 Da.
    Residues 101 Isoelectric Point 4.61
    Sequence maaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqgdsvrpgilv lindadwellgeldyqlqdqdsilfistlhgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch