The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CESG
    PDB Id 1xq1 Target Id GO.2303
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30334, Molecular Weight 28330.78 Da.
    Residues 266 Isoelectric Point 6.52
    Sequence magaeqsqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqkkgfqvtgsv cdaslrpereklmqtvssmfggkldilinnlgairskptldytaedfsfhistnlesayhlsqlahpll kasgcgniifmssiagvvsasvgsiysatkgalnqlarnlacewasdgiranavapaviatplaeavyd defkkvvisrkplgrfgepeevsslvaflcmpaasyitgqticvdggltvngfsyqpqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.316
    Matthews' coefficent 2.13 Rfactor 0.255
    Waters 57 Solvent Content 42.33

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch