.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xq5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Met-Perch Hemoglobin at 1.9A. To be Published
    Site CESG
    PDB Id 1xq5 Target Id GO.34368
    Molecular Characteristics
    Source Perca fluviatilis
    Alias Ids TPS30181, Molecular Weight 15575.11 Da.
    Residues 142 Isoelectric Point 8.63
    Sequence slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhgktimggivd avasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftpevhisydkffsalarala ekyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.29717
    Matthews' coefficent 2.16 Rfactor 0.24298
    Waters 219 Solvent Content 46.00

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch