.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y4o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of isoform 1 of Roadblock/LC7, a light chain in the dynein complex. J.Mol.Biol. 354 1043-1051 2005
    Site CESG
    PDB Id 1y4o Target Id GO.34382
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30145,6396 Molecular Weight 10989.13 Da.
    Residues 96 Isoelectric Point 6.58
    Sequence maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilkarstvreidpqndltfl rirskkneimvapdkdyfliviqnpte
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch