.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ydw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT4G09670. To be published
    Site CESG
    PDB Id 1ydw Target Id GO.19812
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30240, Molecular Weight 39559.93 Da.
    Residues 362 Isoelectric Point 5.61
    Sequence matetqirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyeslled peidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqimdgtmwvhnprta llkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgalgdagwyairatllannfelpkt vtafpgavlneagvilscgaslswedgrtatiycsflanltmeitaigtkgtlrvhdfiipyketeasf ttstkawfndlvtawvsppsehtvktelpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvda vkesvdknyqqislsgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.49 Rfree 0.28254
    Matthews' coefficent 2.55 Rfactor 0.21822
    Waters 123 Solvent Content 51.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch