.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yel

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the B3 domain from Arabidopsis thaliana protein At1g16640. Protein Sci. 14 2478-2483 2005
    Site CESG
    PDB Id 1yel Target Id GO.33931
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30342,6464 Molecular Weight 12021.19 Da.
    Residues 102 Isoelectric Point 5.78
    Sequence madtgevqfmkpfisekssksleiplgfneyfpapfpitvdlldysgrswtvrmkkrgekvfltvgwen fvkdnnledgkylqfiydrdrtfyviiyghnmc
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch