.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yvi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF PUTATIVE HISTIDINE-CONTAINING PHOSPHOTRANSFER PROTEIN FROM RICE, AK104879. To be published
    Site CESG
    PDB Id 1yvi Target Id GO.33957
    Molecular Characteristics
    Source Oryza sativa
    Alias Ids TPS30325, Molecular Weight 16810.31 Da.
    Residues 149 Isoelectric Point 4.64
    Sequence maaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriineiatlleqpv vnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrndfydlrnkfqtmlqle qqiqaydpkqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2272
    Matthews' coefficent 2.80 Rfactor 0.17246
    Waters 319 Solvent Content 55.60

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch