.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z7x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Inhibition of human pancreatic ribonuclease by the human ribonuclease inhibitor protein. J.Mol.Biol. 368 434-449 2007
    Site CESG
    PDB Id 1z7x Target Id GO.78623
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30157, Molecular Weight 49970.45 Da.
    Residues 461 Isoelectric Point 4.71
    Sequence msldiqsldiqceelsdarwaellpllqqcqvvrlddcgltearckdissalrvnpalaelnlrsnelg dvgvhcvlqglqtpsckiqklslqnccltgagcgvlsstlrtlptlqelhlsdnllgdaglqllcegll dpqcrleklqleycslsaasceplasvlrakpdfkeltvsnndineagvrvlcqglkdspcqlealkle scgvtsdncrdlcgivaskaslrelalgsnklgdvgmaelcpgllhpssrlrtlwiwecgitakgcgdl crvlrakeslkelslagnelgdegarllcetllepgcqleslwvkscsftaaccshfssvlaqnrflle lqisnnrledagvrelcqglgqpgsvlrvlwladcdvsdsscsslaatllanhslreldlsnnclgdag ilqlvesvrqpgclleqlvlydiywseemedrlqalekdkpslrvis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.236
    Matthews' coefficent 2.30 Rfactor 0.175
    Waters 854 Solvent Content 46.50

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch