.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zxu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of protein from arabidopsis thaliana AT5G01750. To be published
    Site CESG
    PDB Id 1zxu Target Id GO.24556
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS29796, Molecular Weight 24293.70 Da.
    Residues 217 Isoelectric Point 8.35
    Sequence meqpyvyaypqgsgpsgaptpqaggvvvdpkycapypidmaivrkmmsltdgnfvitdvngnllfkvke pvfglhdkrvlldgsgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvkrssmlqlktkldvflghn kdekrcdfrvkgswlerscvvyagesdaivaqmhrkhtvqsvflgkdnfsvtvypnvdyafiaslvvil ddvnredraa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.231
    Matthews' coefficent 2.50 Rfactor 0.189
    Waters 127 Solvent Content 50.20

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch