The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure and NO binding properties of the nitrophorin-like heme-binding protein from Arabidopsis thaliana gene locus At1g79260.1. Proteins 78 917-931 2010
    Site CESG
    PDB Id 2a13 Target Id GO.6462
    Related PDB Ids 3emm 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS29815, Molecular Weight 18485.08 Da.
    Residues 166 Isoelectric Point 6.92
    Sequence mnqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwkl esgapmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisrefelv dgklsyvvrmstttnplqphlkaildkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.32 Rfree 0.186
    Matthews' coefficent 2.40 Rfactor 0.156
    Waters 329 Solvent Content 48.50

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch