.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bei

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A. Proteins 64 288-293 2006
    Site CESG
    PDB Id 2bei Target Id GO.36731
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30300, Molecular Weight 19154.06 Da.
    Residues 170 Isoelectric Point 5.77
    Sequence masvrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeilpapgkllgp cvvgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgcsqfrlavldwnqramd lykalgaqdlteaegwhffcfqgeatrklagk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.2489
    Matthews' coefficent 2.60 Rfactor 0.2045
    Waters 305 Solvent Content 52.60

    Ligand Information
    Ligands ACO (ACETYL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch